PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J313400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 176aa    MW: 19408 Da    PI: 10.0033
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J313400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.3e-162269148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEd++l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Pavir.J313400.1.p 22 KGLWSPEEDDKLYNHIIRYGVGCWSSVPKLAGLQRCGKSCRLRWINYL 69
                       678*******************************************97 PP

2Myb_DNA-binding49.21.2e-1575119147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  Pavir.J313400.1.p  75 RGSFSQQEEDAIVGLHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 119
                        899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3721769IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-231772IPR009057Homeodomain-like
SuperFamilySSF466896.36E-2920116IPR009057Homeodomain-like
SMARTSM007175.2E-122171IPR001005SANT/Myb domain
PfamPF002491.5E-142269IPR001005SANT/Myb domain
CDDcd001678.67E-112569No hitNo description
PROSITE profilePS5129424.51770124IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-2673124IPR009057Homeodomain-like
SMARTSM007172.2E-1474122IPR001005SANT/Myb domain
PfamPF002495.6E-1475119IPR001005SANT/Myb domain
CDDcd001675.79E-1077117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MGRHAHAGSA AAAAGVQQKL RKGLWSPEED DKLYNHIIRY GVGCWSSVPK LAGLQRCGKS  60
CRLRWINYLR PDLKRGSFSQ QEEDAIVGLH EILGNRWSQI ASHLPGRTDN EIKNFWNSCL  120
KKKLRQRGID PTTHKPISAD AAAAAAALDQ PASQEHKPPA ADAGGFAPKE QHQQVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29201245108B-MYB
1h8a_C8e-291912424128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119125LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.143740.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9616181e-176EU961618.1 Zea mays clone 237078 myb-related protein Hv33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969673.11e-104PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-79MYB3_HORVU; Myb-related protein Hv33
TrEMBLK3XUE11e-104K3XUE1_SETIT; Uncharacterized protein
STRINGSi005548m1e-103(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-74myb domain protein 86